Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_000007065.1: Methanosarcina mazei, Go1 [-] (ncbi)

Genbanks info:

Genbank_acc: WP_011032552.1:PCEFANMJ_00651
Genome uid: 22
730598-733672 [+] (1024)

Sequence:

QSLYARAWYSKALALLNLKNPIGSEKNFEKALEAFDALLEINPKDTVAWQYRGNILRYLDRPDEALEAFEKALAFDPENI
PARYFKGLTLGYLNLPEKALEAFRGVIERDPENAGALYYSGLALNQLGRHTEAVSALSEALKINPDNPGAWYYRGVSLYI
LGKCMEALEAFEKTLALEPSHAGAWEGKAKAYLSLGRRREALRACEKAIELEPSSAGAWETQGKILKGIGRREEALGAFE
KSLILEPMNAENRLEKGRLLGSLGRCGEALLEFESVLQIDSSLTEAKINKGKALLAIGNYQKALDSFSKTLKEGTENSES
WGGMGSCLLALGKYYEAMKAYERALALGTENSCTLSGIGEIYYELGDLTRALEFFEQALSLDIENAFAWNGKGNALCKLG
KYREALEAYENLLTLDYESLPARYNKGIVLSRLKARLKNSGESLENQFQTAFKKYLELSGKLSENKIGSEGWKCRGLAFA
ELGEYEEAIKAFDRAAEYSPEYITPAVYKGISLICLKRYEEALVLFEQAEEIFYTNMGAEGKGDPDEEKKAEESWMMNFA
MNFAGKKPILEILRNAKGFALDALGRYKDAFEAFEDARKVSGNGKISFSGKGIVFAHCGKWKKAIEEFDSVLILDPENVP
ASVMKAFALIRLEEFGKAAEFLEKLTLKDCDSDLSLCLLGFAFSKQGDLEKALRAYRKAIEANPKNIHARNGLAEICFII
GNSTGALKELEASIAEAPDNAYSRSLKGRVELEEQECENALDSFRRALTLDTENQRLMLWDAYGRYIYAESFFDEDSARF
RYALLTAAGKLEKATVCREAKDSELRAYALYFLGLFYCKVHYFRKASERLEECLKLENSRKVKQPAALLLKSIRAKKPKH
AWWEWWFAPGARSFIKKTGFGIIVALIFSILLSHPAASTLPFISWPAAYISQIFYPAGENITSWALYGREYVISVLILSF
LLVLPGLSSGSVENGEIEPETLTPPFPDFYIPVSVLEDFTERLEKSLFSTEPMRESIEKLGKF

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	0	825			737778	36146	3	136:Membrane Protein	15	0	1	634	0	1
2	DeepTMHMM:inside		inside	1	898			792865	36146	9730	15	0	1	634	0	2
3	SMART:SM00028	IPR019734		5	39			737704	36146	1	15	0	1	634	0	3
4	PFAM:PF13424		Tetratricopeptide repeat	5	77	32.3	9.0E-8	737772	36146	717	15	0	1	634	0	4
5	PROSITE_PROFILES:PS50005	IPR019734	TPR repeat profile.	12	46			737782	36146	936	15	0	1	634	0	5
6	SUPERFAMILY:SSF48452	IPR011990	Tetratricopeptide-like helical domain superfamily	15	432			737909	36146	279	15	0	1	634	0	6
7	PROSITE_PROFILES:PS50005	IPR019734	TPR repeat profile.	46	80			737783	36146	936	15	0	1	634	0	7
8	SMART:SM00028	IPR019734		46	80			737765	36146	1	15	0	1	634	0	8
9	SMART:SM00028	IPR019734		80	114			737715	36146	1	15	0	1	634	0	9
10	PFAM:PF13432		Tetratricopeptide repeat	88	149	39.9	4.5E-10	737773	36146	717	15	0	1	634	0	10
11	SMART:SM00028	IPR019734		114	148			737710	36146	1	15	0	1	634	0	11
12	PROSITE_PROFILES:PS50005	IPR019734	TPR repeat profile.	114	148			737900	36146	936	15	0	1	634	0	12
13	PROSITE_PROFILES:PS50005	IPR019734	TPR repeat profile.	148	182			737902	36146	936	15	0	1	634	0	13
14	SMART:SM00028	IPR019734		148	182			737766	36146	1	15	0	1	634	0	14
15	PFAM:PF14559		Tetratricopeptide repeat	166	225	25.1	1.8E-5	737770	36146	717	15	0	1	634	0	15
16	SMART:SM00028	IPR019734		182	216			737707	36146	1	15	0	1	634	0	16
17	PROSITE_PROFILES:PS50005	IPR019734	TPR repeat profile.	182	216			737818	36146	936	15	0	1	634	0	17
18	PROSITE_PROFILES:PS50005	IPR019734	TPR repeat profile.	216	250			737905	36146	936	15	0	1	634	0	18
19	SMART:SM00028	IPR019734		216	250			737711	36146	1	15	0	1	634	0	19
20	SMART:SM00028	IPR019734		250	284			737759	36146	1	15	0	1	634	0	20
21	PROSITE_PROFILES:PS50005	IPR019734	TPR repeat profile.	284	318			737901	36146	936	15	0	1	634	0	21
22	SMART:SM00028	IPR019734		284	318			737714	36146	1	15	0	1	634	0	22
23	PROSITE_PROFILES:PS50005	IPR019734	TPR repeat profile.	318	352			737816	36146	936	15	0	1	634	0	23
24	SMART:SM00028	IPR019734		318	352			737717	36146	1	15	0	1	634	0	24
25	PFAM:PF13424		Tetratricopeptide repeat	320	383	37.2	2.7E-9	737771	36146	717	15	0	1	634	0	25
26	PROSITE_PROFILES:PS50005	IPR019734	TPR repeat profile.	352	386			737811	36146	936	15	0	1	634	0	26
27	PROSITE_PROFILES:PS50293		TPR repeat region circular profile.	352	383			737908	36146	935	15	0	1	634	0	27
28	SMART:SM00028	IPR019734		352	386			737706	36146	1	15	0	1	634	0	28
29	PFAM:PF07719	IPR013105	Tetratricopeptide repeat	386	417	24.3	2.1E-5	737774	36146	717	15	0	1	634	0	29
30	SMART:SM00028	IPR019734		386	420			737764	36146	1	15	0	1	634	0	30
31	PROSITE_PROFILES:PS50005	IPR019734	TPR repeat profile.	386	420			737814	36146	936	15	0	1	634	0	31
32	PROSITE_PROFILES:PS50293		TPR repeat region circular profile.	469	502			737906	36146	935	15	0	1	634	0	32
33	SMART:SM00028	IPR019734		469	503			737708	36146	1	15	0	1	634	0	33
34	PROSITE_PROFILES:PS50005	IPR019734	TPR repeat profile.	469	503			737784	36146	936	15	0	1	634	0	34
35	PFAM:PF00515	IPR001440	Tetratricopeptide repeat	470	503	28.3	9.8E-7	737768	36146	717	15	0	1	634	0	35
36	SUPERFAMILY:SSF48452	IPR011990	Tetratricopeptide-like helical domain superfamily	472	775			737910	36146	279	15	0	1	634	0	36
37	SMART:SM00028	IPR019734		503	537			737767	36146	1	15	0	1	634	0	37
38	SMART:SM00028	IPR019734		571	605			737709	36146	1	15	0	1	634	0	38
39	PROSITE_PROFILES:PS50005	IPR019734	TPR repeat profile.	605	639			737903	36146	936	15	0	1	634	0	39
40	SMART:SM00028	IPR019734		605	639			737712	36146	1	15	0	1	634	0	40
41	SMART:SM00028	IPR019734		673	707			737762	36146	1	15	0	1	634	0	41
42	PROSITE_PROFILES:PS50005	IPR019734	TPR repeat profile.	673	707			737904	36146	936	15	0	1	634	0	42
43	PROSITE_PROFILES:PS50293		TPR repeat region circular profile.	673	707			737907	36146	935	15	0	1	634	0	43
44	PFAM:PF14559		Tetratricopeptide repeat	685	750	38	1.7E-9	737769	36146	717	15	0	1	634	0	44
45	SMART:SM00028	IPR019734		707	741			737716	36146	1	15	0	1	634	0	45
46	PROSITE_PROFILES:PS50005	IPR019734	TPR repeat profile.	741	775			737809	36146	936	15	0	1	634	0	46
47	SMART:SM00028	IPR019734		741	775			737713	36146	1	15	0	1	634	0	47
48	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	825	843			737780	36146	5	136:Membrane Protein	15	0	1	634	0	48
49	SMART:SM00028	IPR019734		827	861			737718	36146	1	15	0	1	634	0	49
50	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	843	900			737775	36146	18	136:Membrane Protein	15	0	1	634	0	50
51	DeepTMHMM:TMhelix		TMhelix	899	918			792866	36146	2056	141:DeepTMHMM: helix	15	0	1	634	5	51
52	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	900	925			737779	36146	5	136:Membrane Protein	15	0	1	634	0	52
53	DeepTMHMM:outside		outside	919	952			792867	36146	10025	15	0	1	634	0	53
54	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	925	944			737777	36146	3	136:Membrane Protein	15	0	1	634	0	54
55	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	944	965			737781	36146	5	136:Membrane Protein	15	0	1	634	0	55
56	DeepTMHMM:TMhelix		TMhelix	953	964			792868	36146	2056	141:DeepTMHMM: helix	15	0	1	634	5	56
57	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	965	1024			737776	36146	18	136:Membrane Protein	15	0	1	634	0	57
58	DeepTMHMM:inside		inside	965	1024			792869	36146	9730	15	0	1	634	0	58

↑ Top