Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_000007065.1: Methanosarcina mazei, Go1 [-] (ncbi)

Genbanks info:

Genbank_acc: WP_011033253.1:PCEFANMJ_01386
Genome uid: 22
1555307-1556476 [+] (389)

Sequence:

KRGDEEIDSGFVERLAGFLGFDEERVQHLFEKIYLARNWGKHDYLFRFDKEISRIERGTVLYEKGDSFEVIMGFPKIRRA
MVLDPTLKKHFSGLEKITVEEKMNGYNVRVAKVKDDILAITRSGYICPYTTEKAKEKLDLKFFDDFPELVLYGEMLGPDN
PYVPKEIYGIDSVEFYIFDIREKNTGNPLPISKKHEILEEYGFLQVECFGEFPLHTAAEQITKIIRELGKKEHEGVVIKD
PDMILAPLKYTSSQSNCSDLRHAFRFYNEAGRDYMLPRIVREGFQTVEWDENEAEFKKRYMQLGESILRPLRESIQSVKN
GQRLYEEVRIRVKDPKTATEFENYLKRLGVDAIFEEPQPIGNEYLINIKKINKSTNDKTQAIWEGELW

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	CDD:cd07894	IPR001072	Adenylation_RNA_ligase	44	389			749066	38918	7996	0	0	1	1349	0	1
2	PRINTS:PR01048	IPR001072	Hypothetical protein Y414 family signature	48	63			748921	38918	7994	0	0	1	1349	0	2
3	SUPERFAMILY:SSF56091		-	71	282			749068	38918	12	0	0	1	1349	0	3
4	PRINTS:PR01048	IPR001072	Hypothetical protein Y414 family signature	73	92			748905	38918	7994	0	0	1	1349	0	4
5	PFAM:PF09414	IPR021122	RNA ligase	96	245	71.2	1.3E-19	749062	38918	4146	0	0	1	1349	0	5
6	PRINTS:PR01048	IPR001072	Hypothetical protein Y414 family signature	118	134			748903	38918	7994	0	0	1	1349	0	6
7	PRINTS:PR01048	IPR001072	Hypothetical protein Y414 family signature	148	164			748915	38918	7994	0	0	1	1349	0	7
8	PRINTS:PR01048	IPR001072	Hypothetical protein Y414 family signature	173	195			748923	38918	7994	0	0	1	1349	0	8
9	PRINTS:PR01048	IPR001072	Hypothetical protein Y414 family signature	229	243			748912	38918	7994	0	0	1	1349	0	9
10	PRINTS:PR01048	IPR001072	Hypothetical protein Y414 family signature	247	261			748918	38918	7994	0	0	1	1349	0	10
11	PFAM:PF18330	IPR041596	Ligase Pab1020 C-terminal region	262	387	143.4	3.30006E-42	749064	38918	7995	0	0	1	1349	0	11
12	PRINTS:PR01048	IPR001072	Hypothetical protein Y414 family signature	271	290			748907	38918	7994	0	0	1	1349	0	12
13	PRINTS:PR01048	IPR001072	Hypothetical protein Y414 family signature	302	317			748909	38918	7994	0	0	1	1349	0	13
14	PRINTS:PR01048	IPR001072	Hypothetical protein Y414 family signature	365	386			749059	38918	7994	0	0	1	1349	0	14

↑ Top