Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_000007065.1: Methanosarcina mazei, Go1 [-] (ncbi)

Genbanks info:

Genbank_acc: WP_011033455.1:PCEFANMJ_01597
Genome uid: 22
1798202-1799182 [+] (326)

Sequence:

EGKKYRTLGQDCGAVSEVMGAVLMISIVVLAFSSVALTIFSEGDSMDPPHTPHTNLRENINTSEDTVEIFHNGGEEIDLK
DIMIILNTGEKRAEFNMSESAVKVFDPKGNQLPSDGVFALGNRIVIDPTGKINITSGNAVDLYFVHTASDQVIQKTKLWK
DVRDLPYWITPHTFPAGTAYDNSTEKWLDTELVDKIDNRPTESFIPKNIAICQNYTFGIDVEELGIPESTSFTKVILKII
STRHDQSPQIRMVPEIYNGSEWTTFNPIPFEGSNKYVETNLTITKYVKNITELENLEVRILAEGNAANQSKKTFWVDFVG
VHVEY

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	0	20			771520	39567	18	136:Membrane Protein	15	0	1	1557	0	1
2	DeepTMHMM:inside		inside	1	20			742070	39567	9730	15	0	1	1557	0	2
3	PFAM:PF07790	IPR012859	Archaeal Type IV pilin, N-terminal	14	89	59.9	3.5E-16	771517	39567	7677	15	0	1	1557	0	3
4	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	20	41			771522	39567	5	136:Membrane Protein	15	0	1	1557	0	4
5	DeepTMHMM:TMhelix		TMhelix	21	38			742072	39567	2056	141:DeepTMHMM: helix	15	0	1	1557	5	5
6	DeepTMHMM:outside		outside	39	326			742074	39567	10025	15	0	1	1557	0	6
7	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	41	326			771524	39567	3	136:Membrane Protein	15	0	1	1557	0	7

↑ Top