Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_017428695.1: Ruminococcus sp., RGIG2705 [+] (ncbi)

Genbanks info:

Genbank_acc: WP_295114485.1:PROKKA_02838
Genome uid: 119
10429-11493 [+] (354)

Sequence:

WLSNYFQRWYLNRAGNIVIATYVYTDDLEISGKIPEWLWEYNVIRYSKAILIPLWSVVCLWGTFRLFYRRELEEPVDVLS
KASERILGDDLDFTVESRSDNELGALCSSFETMRKNLYDSNYQLWKSLEERKRLNSAFSHDLRTPITVLKGYTELAEQLD
GQLPPEKQQDMLRKMSGQIERLERYTEKMSGIHKLEDIIPEESCFIFGQLCKEVYETGSLVCADKSYSQDSGGDKSQELF
TDRELVMQVCENLVANASRYADSRVSCRIYTDSGKLYITFSDDGEGFSEEALRKAWQPFYRGGNENEKEHFGLGLYICRL
LCRKCGGDIALANNENGGGAVTASFDIKKSESR

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	0	49			1371347	453717	3	136:Membrane Protein	15	0	1	762	0	1
2	DeepTMHMM:signal		signal	1	21			1336893	453717	2198	15	0	1	762	0	2
3	DeepTMHMM:outside		outside	22	47			1336894	453717	10025	15	0	1	762	0	3
4	DeepTMHMM:TMhelix		TMhelix	48	65			1336895	453717	2056	141:DeepTMHMM: helix	15	0	1	762	5	4
5	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	49	69			1371349	453717	5	136:Membrane Protein	15	0	1	762	0	5
6	DeepTMHMM:inside		inside	66	354			1336896	453717	9730	15	0	1	762	0	6
7	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	69	354			1371348	453717	18	136:Membrane Protein	15	0	1	762	0	7
8	SMART:SM00304	IPR003660		70	123			1371343	453717	1	15	0	1	762	0	8
9	PROSITE_PROFILES:PS50885	IPR003660	HAMP domain profile.	70	123			1371351	453717	455	15	0	1	762	0	9
10	SUPERFAMILY:SSF158472		-	73	120			1371356	453717	12	15	0	1	762	0	10
11	CDD:cd06225		HAMP	75	118			1371354	453717	457	15	0	1	762	0	11
12	SUPERFAMILY:SSF47384	IPR036097	Signal transduction histidine kinase, dimerisation/phosphoacceptor domain superfamily	117	197			1371355	453717	108	15	0	1	762	0	12
13	CDD:cd00082	IPR003661	HisKA	128	190			1371352	453717	356	15	0	1	762	0	13
14	SMART:SM00388	IPR003661		130	199			1371342	453717	1	15	0	1	762	0	14
15	PFAM:PF00512	IPR003661	His Kinase A (phospho-acceptor) domain	131	191	37.1	2.3E-9	1371345	453717	355	15	0	1	762	0	15
16	PROSITE_PROFILES:PS50109	IPR005467	Histidine kinase domain profile.	137	350			1371350	453717	103	15	0	1	762	0	16
17	SUPERFAMILY:SSF55874	IPR036890	Histidine kinase/HSP90-like ATPase superfamily	224	348			1371357	453717	122	15	0	1	762	0	17
18	SMART:SM00387	IPR003594		241	352			1371344	453717	1	15	0	1	762	0	18
19	PFAM:PF02518	IPR003594	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase	242	347	54.6	1.4E-14	1371346	453717	99	15	0	1	762	0	19
20	CDD:cd00075		HATPase	246	346			1371353	453717	456	15	0	1	762	0	20

↑ Top