Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_000007065.1: Methanosarcina mazei, Go1 [-] (ncbi)

Genbanks info:

Genbank_acc: PCEFANMJ_03367
Genome uid: 22
3884831-3885151 [+] (106)

Sequence:

LSSLFFGASLFLITQIYNINANNSTLVLIWIIGVFPLIYGYMSTPIAGLCSLLFYLWIGLLYSERTGLENLISMKDLFLI
SGIAVHFSGILHSLAEKAKHAEKTF

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:SIGNAL_PEPTIDE_N_REGION		N-terminal region of a signal peptide.	0	3			707776	47373	21	135:all secretion /signal peptide, lipo	13	1	1	3304	3	1
2	PHOBIUS:SIGNAL_PEPTIDE		Signal peptide region	0	19			707781	47373	19	135:all secretion /signal peptide, lipo	13	0	1	3304	3	2
3	PFAM:PF09925	IPR018677	Predicted membrane protein (DUF2157)	1	47	36.7	3.4E-9	707772	47373	4467	136:Membrane Protein	13	0	1	3304	0	3
4	DeepTMHMM:inside		inside	1	4			808416	47373	9730	13	0	1	3304	0	4
5	PHOBIUS:SIGNAL_PEPTIDE_H_REGION		Hydrophobic region of a signal peptide.	3	14			707780	47373	24	135:all secretion /signal peptide, lipo	13	1	1	3304	3	5
6	DeepTMHMM:TMhelix		TMhelix	5	18			808417	47373	2056	141:DeepTMHMM: helix	13	0	1	3304	5	6
7	PHOBIUS:SIGNAL_PEPTIDE_C_REGION		C-terminal region of a signal peptide.	14	19			707777	47373	26	135:all secretion /signal peptide, lipo	13	1	1	3304	3	7
8	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	19	28			707773	47373	3	136:Membrane Protein	13	0	1	3304	0	8
9	DeepTMHMM:outside		outside	19	26			808418	47373	10025	13	0	1	3304	0	9
10	DeepTMHMM:TMhelix		TMhelix	27	42			808419	47373	2056	141:DeepTMHMM: helix	13	0	1	3304	5	10
11	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	28	57			707778	47373	5	136:Membrane Protein	13	0	1	3304	0	11
12	DeepTMHMM:inside		inside	43	46			808509	47373	9730	13	0	1	3304	0	12
13	DeepTMHMM:TMhelix		TMhelix	47	63			808511	47373	2056	141:DeepTMHMM: helix	13	0	1	3304	5	13
14	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	57	77			707775	47373	18	136:Membrane Protein	13	0	1	3304	0	14
15	DeepTMHMM:outside		outside	64	76			808513	47373	10025	13	0	1	3304	0	15
16	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	77	96			707779	47373	5	136:Membrane Protein	13	0	1	3304	0	16
17	DeepTMHMM:TMhelix		TMhelix	77	92			808515	47373	2056	141:DeepTMHMM: helix	13	0	1	3304	5	17
18	DeepTMHMM:inside		inside	93	106			808518	47373	9730	13	0	1	3304	0	18
19	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	96	106			707774	47373	3	136:Membrane Protein	13	0	1	3304	0	19

↑ Top