Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_937959475.1: uncultured Eubacterium sp., na [+] (ncbi)

Genbanks info:

Genbank_acc: PROKKA_01291
Genome uid: 226
17076-17195 [+] (39)
Sequence:
```
KIFKVIIIMAAIIMATGIGVYLCSQAKETEKTETAVMI
```

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	0	5			2830550	952545	3	136:Membrane Protein	0	0	0	656	0	1
2	PHOBIUS:SIGNAL_PEPTIDE		Signal peptide region	0	30			2231252	952545	19	135:all secretion /signal peptide, lipo	13	0	0	656	3	2
3	PHOBIUS:SIGNAL_PEPTIDE_N_REGION		N-terminal region of a signal peptide.	0	11			2231250	952545	21	135:all secretion /signal peptide, lipo	13	0	0	656	3	3
4	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	0	38			2018560	952545	18	136:Membrane Protein	13	0	1	656	0	4
5	PHOBIUS:SIGNAL_PEPTIDE_N_REGION		N-terminal region of a signal peptide.	0	5			936333	952545	21	135:all secretion /signal peptide, lipo	13	0	1	656	3	5
6	PHOBIUS:SIGNAL_PEPTIDE		Signal peptide region	0	20			936332	952545	19	135:all secretion /signal peptide, lipo	13	0	1	656	3	6
7	DeepTMHMM:signal		signal	1	20			900621	952545	2198	13	0	1	656	0	7
8	DeepTMHMM:inside		inside	1	38			2030292	952545	9730	13	0	1	656	0	8
9	SUPERFAMILY:SSF53784	IPR035966	Phosphofructokinase superfamily	2	95			2677872	952545	2592	0	0	0	656	0	9
10	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	5	24			2830551	952545	5	136:Membrane Protein	0	0	0	656	0	10
11	PFAM:PF04221	IPR007337	RelB antitoxin	5	79	59.1	3.0E-16	2702153	952545	4212	0	0	0	656	0	11
12	PHOBIUS:SIGNAL_PEPTIDE_H_REGION		Hydrophobic region of a signal peptide.	5	16			936329	952545	24	135:all secretion /signal peptide, lipo	13	0	1	656	3	12
13	PHOBIUS:SIGNAL_PEPTIDE_H_REGION		Hydrophobic region of a signal peptide.	11	22			2231253	952545	24	135:all secretion /signal peptide, lipo	13	0	0	656	3	13
14	PHOBIUS:SIGNAL_PEPTIDE_C_REGION		C-terminal region of a signal peptide.	16	20			936330	952545	26	135:all secretion /signal peptide, lipo	13	0	1	656	3	14
15	PFAM:PF00365	IPR000023	Phosphofructokinase	19	95	60	2.2E-16	2677871	952545	2591	0	0	0	656	0	15
16	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	20	439			936328	952545	3	136:Membrane Protein	13	0	1	656	0	16
17	SIGNALP6:SP		SP	20	21	0		892312	952545	1978	135:all secretion /signal peptide, lipo	13	0	1	656	0	17
18	DeepTMHMM:outside		outside	21	439			900623	952545	10025	13	0	1	656	0	18
19	PHOBIUS:SIGNAL_PEPTIDE_C_REGION		C-terminal region of a signal peptide.	22	30			2231251	952545	26	135:all secretion /signal peptide, lipo	13	0	0	656	3	19
20	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	24	39			2830549	952545	18	136:Membrane Protein	0	0	0	656	0	20
21	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	30	467			2231249	952545	3	136:Membrane Protein	13	0	0	656	0	21
22	SIGNALP6:SP		SP	32	33	0		2241354	952545	1978	135:all secretion /signal peptide, lipo	13	0	0	656	0	22
23	SUPERFAMILY:SSF161098	IPR035906	MetI-like superfamily	37	307			2018567	952545	225	13	0	1	656	0	23
24	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	38	60			2018554	952545	5	136:Membrane Protein	13	0	1	656	0	24
25	DeepTMHMM:TMhelix		TMhelix	39	59			2030294	952545	2056	141:DeepTMHMM: helix	13	0	1	656	6	25
26	SUPERFAMILY:SSF48452	IPR011990	Tetratricopeptide-like helical domain superfamily	53	240			936342	952545	279	13	0	1	656	0	26
27	PFAM:PF07833	IPR012854	Copper amine oxidase N-terminal domain	55	141	73.5	1.4E-20	2231248	952545	467	4:S-layer Homology:PFAM	13	0	0	656	0	27
28	SUPERFAMILY:SSF55383	IPR036582	Copper amine oxidase-like, N-terminal domain superfamily	56	139			2231254	952545	471	13	0	0	656	0	28
29	DeepTMHMM:outside		outside	60	103			2030296	952545	10025	13	0	1	656	0	29
30	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	60	103			2018563	952545	3	136:Membrane Protein	13	0	1	656	0	30
31	CDD:cd06261	IPR000515	TM_PBP2	99	285			2018566	952545	224	13	0	1	656	0	31
32	PROSITE_PROFILES:PS50928	IPR000515	ABC transporter integral membrane type-1 domain profile.	99	292			2018565	952545	223	136:Membrane Protein	13	0	1	656	0	32
33	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	103	125			2018552	952545	5	136:Membrane Protein	13	0	1	656	0	33
34	DeepTMHMM:TMhelix		TMhelix	104	121			2030298	952545	2056	141:DeepTMHMM: helix	13	0	1	656	6	34
35	PFAM:PF00528	IPR000515	Binding-protein-dependent transport system inner membrane component	119	299	68.7	5.2E-19	2018551	952545	220	136:Membrane Protein	13	0	1	656	0	35
36	DeepTMHMM:inside		inside	122	134			2030300	952545	9730	13	0	1	656	0	36
37	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	125	136			2018558	952545	18	136:Membrane Protein	13	0	1	656	0	37
38	DeepTMHMM:TMhelix		TMhelix	135	146			2030302	952545	2056	141:DeepTMHMM: helix	13	0	1	656	6	38
39	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	136	157			2018556	952545	5	136:Membrane Protein	13	0	1	656	0	39
40	DeepTMHMM:outside		outside	147	168			2030304	952545	10025	13	0	1	656	0	40
41	SMART:SM00028	IPR019734		150	184			936323	952545	1	13	0	1	656	0	41
42	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	157	168			2018564	952545	3	136:Membrane Protein	13	0	1	656	0	42
43	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	168	196			2018557	952545	5	136:Membrane Protein	13	0	1	656	0	43
44	DeepTMHMM:TMhelix		TMhelix	169	187			2030307	952545	2056	141:DeepTMHMM: helix	13	0	1	656	6	44
45	SUPERFAMILY:SSF48452	IPR011990	Tetratricopeptide-like helical domain superfamily	186	334			2231255	952545	279	13	0	0	656	0	45
46	DeepTMHMM:inside		inside	188	224			2030309	952545	9730	13	0	1	656	0	46
47	PROSITE_PROFILES:PS50005	IPR019734	TPR repeat profile.	194	228			936337	952545	936	13	0	1	656	0	47
48	SMART:SM00028	IPR019734		194	228			936325	952545	1	13	0	1	656	0	48
49	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	196	215			2018559	952545	18	136:Membrane Protein	13	0	1	656	0	49
50	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	215	237			2018553	952545	5	136:Membrane Protein	13	0	1	656	0	50
51	DeepTMHMM:TMhelix		TMhelix	225	237			2030313	952545	2056	141:DeepTMHMM: helix	13	0	1	656	6	51
52	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	237	270			2018562	952545	3	136:Membrane Protein	13	0	1	656	0	52
53	DeepTMHMM:outside		outside	238	273			2030315	952545	10025	13	0	1	656	0	53
54	SMART:SM00028	IPR019734		248	282			936324	952545	1	13	0	1	656	0	54
55	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	270	292			2018555	952545	5	136:Membrane Protein	13	0	1	656	0	55
56	DeepTMHMM:TMhelix		TMhelix	274	292			2030317	952545	2056	141:DeepTMHMM: helix	13	0	1	656	6	56
57	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	292	307			2018561	952545	18	136:Membrane Protein	13	0	1	656	0	57
58	DeepTMHMM:inside		inside	293	307			2030319	952545	9730	13	0	1	656	0	58
59	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	439	459			936335	952545	5	136:Membrane Protein	13	0	1	656	0	59
60	DeepTMHMM:TMhelix		TMhelix	440	459			900624	952545	2056	141:DeepTMHMM: helix	13	0	1	656	6	60
61	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	459	701			936331	952545	18	136:Membrane Protein	13	0	1	656	0	61
62	DeepTMHMM:inside		inside	460	701			900625	952545	9730	13	0	1	656	0	62
63	PFAM:PF07730	IPR011712	Histidine kinase	499	563	25.8	1.2E-5	936327	952545	1640	13	0	1	656	0	63
64	SUPERFAMILY:SSF55874	IPR036890	Histidine kinase/HSP90-like ATPase superfamily	585	695			936344	952545	122	13	0	1	656	0	64
65	SMART:SM00387	IPR003594		604	698			936322	952545	1	13	0	1	656	0	65
66	PFAM:PF02518	IPR003594	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase	607	697	27.2	4.2E-6	936326	952545	99	13	0	1	656	0	66
67	PROSITE_PROFILES:PS50109	IPR005467	Histidine kinase domain profile.	609	698			936339	952545	103	13	0	1	656	0	67
68	CDD:cd16917		HATPase_UhpB-NarQ-NarX-like	609	695			936340	952545	3645	13	0	1	656	0	68
69	PRINTS:PR00344	IPR004358	Bacterial sensor protein C-terminal signature	640	655			936320	952545	95	13	0	1	656	0	69
70	PRINTS:PR00344	IPR004358	Bacterial sensor protein C-terminal signature	657	676			936319	952545	95	13	0	1	656	0	70
71	PRINTS:PR00344	IPR004358	Bacterial sensor protein C-terminal signature	681	695			936321	952545	95	13	0	1	656	0	71

↑ Top