Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_022782785.1: Clostridium sp., na [+] (ncbi)

Genbanks info:

Genbank_acc: WP_302636690.1:PROKKA_00486
Genome uid: 227
1214-2533 [+] (439)

Sequence:

AKQIVAIVGRPNVGKSTLFNKLAGKRISIVQDTPGVTRDRVYAEAEWLNHTFTMIDTGGIEPENQDIILTQMRRQANIAI
ETADVIVFIVDGKEGLTAADHEVATMLRKSKKPIVLVVNKVDSIKEEDNAWEFYNLGIGDPITISASQGLGLGDMLDRVV
EHFEEESTGEEEEENIKIAMIGKPNVGKSSLINKLLGEERLIVSDVAGTTRDAIDSKLETEFGKFTLIDTAGLRRKSKVK
EEIERYSVIRTYTAIERADVCILMIDATEGVTEQDEKIIGYAHELGKAIMVIVNKWDLIEKDDKTMDVYKKDLANSLKFL
SYAKYLFISAKTGQRTHKVLEMAKECYDNYNKRIGTGILNDVISKAILMKEPPVVALKRLKVYYATQVATKPPKFVFFVN
DVNARHFSYERYLENRLRDSFDFSGTGIQIEYRERKDK

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	SMART:SM00382	IPR003593		1	167			2866346	956338	1	0	0	0	354	0	1
2	PROSITE_PROFILES:PS51712	IPR031166	EngA-type guanine nucleotide-binding (G) domain profile.	3	168			2866351	956338	2474	0	0	0	354	0	2
3	PRINTS:PR00326	IPR006073	GTP1/OBG GTP-binding protein family signature	5	26			2866343	956338	495	0	0	0	354	0	3
4	PFAM:PF01926	IPR006073	50S ribosome-binding GTPase	5	121	98.4	2.7E-28	2866348	956338	496	0	0	0	354	0	4
5	SUPERFAMILY:SSF52540	IPR027417	P-loop containing nucleoside triphosphate hydrolase	5	167			2866354	956338	78	0	0	0	354	0	5
6	CDD:cd01894		EngA1	6	164			2866353	956338	2476	0	0	0	354	0	6
7	PRINTS:PR00326	IPR006073	GTP1/OBG GTP-binding protein family signature	73	92			2866344	956338	495	0	0	0	354	0	7
8	SUPERFAMILY:SSF52540	IPR027417	P-loop containing nucleoside triphosphate hydrolase	139	437			2866355	956338	78	0	0	0	354	0	8
9	SMART:SM00382	IPR003593		174	315			2866345	956338	1	0	0	0	354	0	9
10	CDD:cd01895		EngA2	175	348			2866352	956338	2475	0	0	0	354	0	10
11	PROSITE_PROFILES:PS51712	IPR031166	EngA-type guanine nucleotide-binding (G) domain profile.	176	352			2866350	956338	2474	0	0	0	354	0	11
12	PFAM:PF01926	IPR006073	50S ribosome-binding GTPase	177	296	91.6	3.5E-26	2866349	956338	496	0	0	0	354	0	12
13	PFAM:PF14714	IPR032859	KH-domain-like of EngA bacterial GTPase enzymes, C-terminal	353	434	104	3.9E-30	2866347	956338	2473	0	0	0	354	0	13

↑ Top