Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_022782785.1: Clostridium sp., na [+] (ncbi)

Genbanks info:

Genbank_acc: PROKKA_00610
Genome uid: 227
2948-3133 [+] (61)

Sequence:

KFMIQSYPMVVSREMLMDKVWGYEYYGDTRVIDAHMKNIRKKIKEDYIKTIKGVGYVLEK

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	0	5			1371929	956696	3	136:Membrane Protein	0	0	1	712	0	1
2	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	0	19			1502403	956696	3	136:Membrane Protein	0	0	1	712	0	2
3	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	0	19			2703633	956696	3	136:Membrane Protein	0	0	0	712	0	3
4	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	0	5			2732916	956696	3	136:Membrane Protein	0	0	0	712	0	4
5	PHOBIUS:SIGNAL_PEPTIDE		Signal peptide region	0	23			2766974	956696	19	135:all secretion /signal peptide, lipo	0	0	0	712	3	5
6	PHOBIUS:SIGNAL_PEPTIDE_N_REGION		N-terminal region of a signal peptide.	0	6			2766976	956696	21	135:all secretion /signal peptide, lipo	0	0	0	712	3	6
7	PFAM:PF00486	IPR001867	Transcriptional regulatory protein, C terminal	0	59	69.5	1.9E-19	2875607	956696	124	0	0	0	712	0	7
8	PROSITE_PROFILES:PS51755	IPR001867	OmpR/PhoB-type DNA-binding domain profile.	0	61			2875608	956696	126	0	0	0	712	0	8
9	CDD:cd00383	IPR001867	trans_reg_C	0	59			2875609	956696	128	0	0	0	712	0	9
10	DeepTMHMM:outside		outside	1	4			1354409	956696	10025	0	0	1	712	0	10
11	DeepTMHMM:inside		inside	1	4			1465409	956696	9730	0	0	1	712	0	11
12	PFAM:PF00916	IPR011547	Sulfate permease family	1	369	353.7	0	1502378	956696	4514	0	0	1	712	0	12
13	SUPERFAMILY:SSF74731	IPR035566	Ribosomal protein L20, C-terminal	1	114			2666903	956696	31	0	0	0	712	0	13
14	DeepTMHMM:inside		inside	1	21			2715523	956696	9730	0	0	0	712	0	14
15	SMART:SM00862	IPR001867		1	59			2875606	956696	1	0	0	0	712	0	15
16	SUPERFAMILY:SSF46894	IPR016032	Signal transduction response regulator, C-terminal effector	1	60			2875610	956696	130	0	0	0	712	0	16
17	PFAM:PF00453	IPR005813	Ribosomal protein L20	2	109	153.7	1.4013E-45	2666901	956696	29	0	0	0	712	0	17
18	DeepTMHMM:TMhelix		TMhelix	5	22			1354457	956696	2056	141:DeepTMHMM: helix	0	0	1	712	6	18
19	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	5	25			1371930	956696	5	136:Membrane Protein	0	0	1	712	0	19
20	DeepTMHMM:TMhelix		TMhelix	5	25			1465412	956696	2056	141:DeepTMHMM: helix	0	0	1	712	6	20
21	CDD:cd07026	IPR005813	Ribosomal_L20	5	110			2666902	956696	30	0	0	0	712	0	21
22	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	5	30			2732923	956696	5	136:Membrane Protein	0	0	0	712	0	22
23	PHOBIUS:SIGNAL_PEPTIDE_H_REGION		Hydrophobic region of a signal peptide.	6	18			2766977	956696	24	135:all secretion /signal peptide, lipo	0	0	0	712	3	23
24	PRINTS:PR00062	IPR005813	Ribosomal protein L20 signature	11	41			2666900	956696	28	0	0	0	712	0	24
25	PFAM:PF07963	IPR012902	Prokaryotic N-terminal methylation motif	13	36	29.7	3.0E-7	2703631	956696	2950	0	0	0	712	0	25
26	SUPERFAMILY:SSF54523	IPR045584	Pilin-like	16	122			2703635	956696	2951	0	0	0	712	0	26
27	SIGNALP6:PILIN		PILIN	16	17	0		2710899	956696	2004	135:all secretion /signal peptide, lipo	0	0	0	712	3	27
28	PHOBIUS:SIGNAL_PEPTIDE_C_REGION		C-terminal region of a signal peptide.	18	23			2766975	956696	26	135:all secretion /signal peptide, lipo	0	0	0	712	3	28
29	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	19	46			1502385	956696	5	136:Membrane Protein	0	0	1	712	0	29
30	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	19	40			2703632	956696	5	136:Membrane Protein	0	0	0	712	0	30
31	DeepTMHMM:TMhelix		TMhelix	22	38			2715524	956696	2056	141:DeepTMHMM: helix	0	0	0	712	6	31
32	DeepTMHMM:inside		inside	23	197			1354460	956696	9730	0	0	1	712	0	32
33	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	23	142			2766978	956696	3	136:Membrane Protein	0	0	0	712	0	33
34	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	25	197			1371932	956696	18	136:Membrane Protein	0	0	1	712	0	34
35	DeepTMHMM:outside		outside	26	30			1465414	956696	10025	0	0	1	712	0	35
36	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	30	41			2732930	956696	18	136:Membrane Protein	0	0	0	712	0	36
37	DeepTMHMM:TMhelix		TMhelix	31	47			1465416	956696	2056	141:DeepTMHMM: helix	0	0	1	712	6	37
38	DeepTMHMM:outside		outside	39	140			2715525	956696	10025	0	0	0	712	0	38
39	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	40	140			2703634	956696	18	136:Membrane Protein	0	0	0	712	0	39
40	PRINTS:PR00062	IPR005813	Ribosomal protein L20 signature	41	71			2666898	956696	28	0	0	0	712	0	40
41	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	41	59			2732924	956696	5	136:Membrane Protein	0	0	0	712	0	41
42	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	46	52			1502398	956696	18	136:Membrane Protein	0	0	1	712	0	42
43	DeepTMHMM:inside		inside	48	53			1465418	956696	9730	0	0	1	712	0	43
44	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	52	74			1502391	956696	5	136:Membrane Protein	0	0	1	712	0	44
45	DeepTMHMM:TMhelix		TMhelix	54	71			1465420	956696	2056	141:DeepTMHMM: helix	0	0	1	712	6	45
46	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	59	70			2732917	956696	3	136:Membrane Protein	0	0	0	712	0	46
47	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	70	88			2732922	956696	5	136:Membrane Protein	0	0	0	712	0	47
48	DeepTMHMM:outside		outside	72	82			1465422	956696	10025	0	0	1	712	0	48
49	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	74	79			1502401	956696	3	136:Membrane Protein	0	0	1	712	0	49
50	PRINTS:PR00062	IPR005813	Ribosomal protein L20 signature	74	101			2666899	956696	28	0	0	0	712	0	50
51	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	79	101			1502381	956696	5	136:Membrane Protein	0	0	1	712	0	51
52	DeepTMHMM:TMhelix		TMhelix	83	101			1465424	956696	2056	141:DeepTMHMM: helix	0	0	1	712	6	52
53	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	88	99			2732928	956696	18	136:Membrane Protein	0	0	0	712	0	53
54	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	99	120			2732921	956696	5	136:Membrane Protein	0	0	0	712	0	54
55	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	101	112			1502397	956696	18	136:Membrane Protein	0	0	1	712	0	55
56	DeepTMHMM:inside		inside	102	113			1465426	956696	9730	0	0	1	712	0	56
57	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	112	135			1502383	956696	5	136:Membrane Protein	0	0	1	712	0	57
58	DeepTMHMM:TMhelix		TMhelix	114	131			1465428	956696	2056	141:DeepTMHMM: helix	0	0	1	712	6	58
59	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	120	125			2732918	956696	3	136:Membrane Protein	0	0	0	712	0	59
60	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	125	151			2732925	956696	5	136:Membrane Protein	0	0	0	712	0	60
61	DeepTMHMM:outside		outside	132	158			1465430	956696	10025	0	0	1	712	0	61
62	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	135	154			1502400	956696	3	136:Membrane Protein	0	0	1	712	0	62
63	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	151	157			2732927	956696	18	136:Membrane Protein	0	0	0	712	0	63
64	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	154	176			1502393	956696	5	136:Membrane Protein	0	0	1	712	0	64
65	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	157	182			2732920	956696	5	136:Membrane Protein	0	0	0	712	0	65
66	DeepTMHMM:TMhelix		TMhelix	159	176			1465432	956696	2056	141:DeepTMHMM: helix	0	0	1	712	6	66
67	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	176	182			1502395	956696	18	136:Membrane Protein	0	0	1	712	0	67
68	DeepTMHMM:inside		inside	177	182			1465434	956696	9730	0	0	1	712	0	68
69	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	182	201			1502392	956696	5	136:Membrane Protein	0	0	1	712	0	69
70	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	182	187			2732919	956696	3	136:Membrane Protein	0	0	0	712	0	70
71	DeepTMHMM:TMhelix		TMhelix	183	200			1465436	956696	2056	141:DeepTMHMM: helix	0	0	1	712	6	71
72	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	187	207			2732926	956696	5	136:Membrane Protein	0	0	0	712	0	72
73	DeepTMHMM:outside		outside	201	232			1465438	956696	10025	0	0	1	712	0	73
74	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	201	229			1502404	956696	3	136:Membrane Protein	0	0	1	712	0	74
75	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	207	427			2732929	956696	18	136:Membrane Protein	0	0	0	712	0	75
76	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	229	252			1502387	956696	5	136:Membrane Protein	0	0	1	712	0	76
77	PROSITE_PROFILES:PS51832	IPR037522	HD-GYP domain profile.	230	427			2732931	956696	828	0	0	0	712	0	77
78	DeepTMHMM:TMhelix		TMhelix	233	252			1465440	956696	2056	141:DeepTMHMM: helix	0	0	1	712	6	78
79	SUPERFAMILY:SSF109604		-	240	415			2732933	956696	12	0	0	0	712	0	79
80	SMART:SM00471	IPR003607		248	384			2732914	956696	1	0	0	0	712	0	80
81	CDD:cd00077	IPR003607	HDc	251	381			2732932	956696	238	0	0	0	712	0	81
82	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	252	306			1502394	956696	18	136:Membrane Protein	0	0	1	712	0	82
83	DeepTMHMM:inside		inside	253	306			1465442	956696	9730	0	0	1	712	0	83
84	PFAM:PF13487		HD domain	303	365	72.7	2.0E-20	2732915	956696	236	0	0	0	712	0	84
85	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	306	328			1502390	956696	5	136:Membrane Protein	0	0	1	712	0	85
86	DeepTMHMM:TMhelix		TMhelix	307	327			1465445	956696	2056	141:DeepTMHMM: helix	0	0	1	712	6	86
87	DeepTMHMM:outside		outside	328	332			1465486	956696	10025	0	0	1	712	0	87
88	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	328	333			1502402	956696	3	136:Membrane Protein	0	0	1	712	0	88
89	DeepTMHMM:TMhelix		TMhelix	333	347			1465487	956696	2056	141:DeepTMHMM: helix	0	0	1	712	6	89
90	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	333	351			1502389	956696	5	136:Membrane Protein	0	0	1	712	0	90
91	DeepTMHMM:inside		inside	348	360			1465488	956696	9730	0	0	1	712	0	91
92	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	351	362			1502396	956696	18	136:Membrane Protein	0	0	1	712	0	92
93	DeepTMHMM:TMhelix		TMhelix	361	378			1465489	956696	2056	141:DeepTMHMM: helix	0	0	1	712	6	93
94	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	362	395			1502388	956696	5	136:Membrane Protein	0	0	1	712	0	94
95	DeepTMHMM:outside		outside	379	380			1465490	956696	10025	0	0	1	712	0	95
96	DeepTMHMM:TMhelix		TMhelix	381	397			1465491	956696	2056	141:DeepTMHMM: helix	0	0	1	712	6	96
97	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	395	553			1502399	956696	3	136:Membrane Protein	0	0	1	712	0	97
98	DeepTMHMM:inside		inside	398	553			1465492	956696	9730	0	0	1	712	0	98
99	PROSITE_PROFILES:PS50801	IPR002645	STAS domain profile.	419	535			1502405	956696	2505	0	0	1	712	0	99
100	CDD:cd07042		STAS_SulP_like_sulfate_transporter	421	528			1502406	956696	4515	0	0	1	712	0	100
101	PFAM:PF01740	IPR002645	STAS domain	422	531	64.6	5.7E-18	1502376	956696	2504	0	0	1	712	0	101
102	SUPERFAMILY:SSF52091	IPR036513	STAS domain superfamily	422	532			1502407	956696	2507	0	0	1	712	0	102

↑ Top