Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_022782785.1: Clostridium sp., na [+] (ncbi)

Genbanks info:

Genbank_acc: PROKKA_00809
Genome uid: 227
7336-7632 [+] (98)

Sequence:

DPIQGGAGTSANMNINEVVANRAIEILGGEKGNYDIVNPNDHVNMCQSTNDVFPTAGKITAIKMIHQVILQLERLYNALI
AKSFAFENILKMGRTQL

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	0	1236			2295611	957325	18	136:Membrane Protein	15	0	0	1341	0	1
2	SUPERFAMILY:SSF48557	IPR008948	L-Aspartase-like	1	98			2873360	957325	1201	0	0	0	1341	0	2
3	CDD:cd04859		Prim_Pol	1	102			2295620	957325	3384	15	0	0	1341	0	3
4	DeepTMHMM:inside		inside	1	712			2303905	957325	9730	15	0	0	1341	0	4
5	PFAM:PF00206	IPR022761	Lyase	1	98	80.5	1.4E-22	2873359	957325	1198	0	0	0	1341	0	5
6	PFAM:PF09250	IPR015330	Bifunctional DNA primase/polymerase, N-terminal	1	98	68.5	8.6E-19	2295594	957325	1662	15	0	0	1341	0	6
7	SUPERFAMILY:SSF56747		-	2	106			2295624	957325	12	15	0	0	1341	0	7
8	SUPERFAMILY:SSF46785	IPR036390	Winged helix DNA-binding domain superfamily	3	78			2726597	957325	42	0	0	0	1341	0	8
9	PROSITE_PROFILES:PS50949	IPR000524	GntR-type HTH domain profile.	8	77			2726595	957325	323	0	0	0	1341	0	9
10	CDD:cd07377	IPR000524	WHTH_GntR	9	75			2726596	957325	324	0	0	0	1341	0	10
11	PFAM:PF00392	IPR000524	Bacterial regulatory proteins, gntR family	11	74	58	5.5E-16	2726594	957325	322	0	0	0	1341	0	11
12	SMART:SM00345	IPR000524		14	74			2726593	957325	1	0	0	0	1341	0	12
13	SUPERFAMILY:SSF53335	IPR029063	S-adenosyl-L-methionine-dependent methyltransferase superfamily	30	162			2700828	957325	167	0	0	0	1341	0	13
14	PFAM:PF13489		Methyltransferase domain	30	148	47.5	1.7E-12	2700826	957325	813	0	0	0	1341	0	14
15	PROSITE_PROFILES:PS51918	IPR007197	Radical SAM core domain profile.	34	246			2662838	957325	190	0	0	0	1341	0	15
16	SMART:SM00729	IPR006638		38	239			2662835	957325	1	0	0	0	1341	0	16
17	SUPERFAMILY:SSF102114		-	40	309			2662840	957325	12	0	0	0	1341	0	17
18	CDD:cd01335		Radical_SAM	42	178			2662839	957325	258	0	0	0	1341	0	18
19	CDD:cd02440		AdoMet_MTases	44	144			2700827	957325	632	0	0	0	1341	0	19
20	PFAM:PF04055	IPR007197	Radical SAM superfamily	45	185	66.8	2.8E-18	2662836	957325	48	0	0	0	1341	0	20
21	SMART:SM00942	IPR014820		115	182			2295593	957325	1	15	0	0	1341	0	21
22	PFAM:PF08708	IPR014820	Primase C terminal 1 (PriCT-1)	116	182	69.6	1.4E-19	2295608	957325	218	15	0	0	1341	0	22
23	SMART:SM00885	IPR014818		196	348			2295592	957325	1	15	0	0	1341	0	23
24	PFAM:PF08706	IPR014818	D5 N terminal like	196	347	122	2.4E-35	2295595	957325	6664	15	0	0	1341	0	24
25	PFAM:PF13186	IPR023885	Iron-sulfur cluster-binding domain	261	307	25.3	1.5E-5	2662837	957325	2081	0	0	0	1341	0	25
26	PFAM:PF05593	IPR031325	RHS Repeat	428	465	36.4	5.2E-9	2295603	957325	713	15	0	0	1341	0	26
27	PFAM:PF05593	IPR031325	RHS Repeat	517	555	29.6	7.1E-7	2295604	957325	713	15	0	0	1341	0	27
28	PFAM:PF05593	IPR031325	RHS Repeat	559	596	40.2	3.5E-10	2295601	957325	713	15	0	0	1341	0	28
29	SUPERFAMILY:SSF82171		-	582	857			2295622	957325	12	15	0	0	1341	0	29
30	PFAM:PF05593	IPR031325	RHS Repeat	601	638	31.2	2.2E-7	2295607	957325	713	15	0	0	1341	0	30
31	PFAM:PF05593	IPR031325	RHS Repeat	622	659	38.2	1.4E-9	2295599	957325	713	15	0	0	1341	0	31
32	PFAM:PF05593	IPR031325	RHS Repeat	643	680	25.8	1.1E-5	2295605	957325	713	15	0	0	1341	0	32
33	PFAM:PF05593	IPR031325	RHS Repeat	685	722	29.2	9.2E-7	2295606	957325	713	15	0	0	1341	0	33
34	DeepTMHMM:TMhelix		TMhelix	713	722			2303906	957325	2056	141:DeepTMHMM: helix	15	0	0	1341	6	34
35	DeepTMHMM:outside		outside	723	1625			2303907	957325	10025	15	0	0	1341	0	35
36	PFAM:PF05593	IPR031325	RHS Repeat	727	763	27.4	3.6E-6	2295602	957325	713	15	0	0	1341	0	36
37	PFAM:PF05593	IPR031325	RHS Repeat	769	806	29.6	7.0E-7	2295597	957325	713	15	0	0	1341	0	37
38	PFAM:PF05593	IPR031325	RHS Repeat	835	869	29.5	7.6E-7	2295598	957325	713	15	0	0	1341	0	38
39	PFAM:PF05593	IPR031325	RHS Repeat	872	910	40.9	2.1E-10	2295600	957325	713	15	0	0	1341	0	39
40	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	1236	1263			2295617	957325	5	136:Membrane Protein	15	0	0	1341	0	40
41	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	1263	1282			2295610	957325	3	136:Membrane Protein	15	0	0	1341	0	41
42	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	1282	1301			2295615	957325	5	136:Membrane Protein	15	0	0	1341	0	42
43	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	1301	1307			2295612	957325	18	136:Membrane Protein	15	0	0	1341	0	43
44	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	1307	1326			2295616	957325	5	136:Membrane Protein	15	0	0	1341	0	44
45	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	1326	1345			2295609	957325	3	136:Membrane Protein	15	0	0	1341	0	45
46	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	1345	1367			2295614	957325	5	136:Membrane Protein	15	0	0	1341	0	46
47	SMART:SM00306	IPR003587		1363	1458			2295591	957325	1	15	0	0	1341	0	47
48	SUPERFAMILY:SSF51294	IPR036844	Hint domain superfamily	1365	1501			2295623	957325	449	15	0	0	1341	0	48
49	CDD:cd00081		Hint	1365	1500			2295621	957325	448	15	0	0	1341	0	49
50	PROSITE_PROFILES:PS50817	IPR006141	Intein N-terminal splicing motif profile.	1365	1437			2295618	957325	446	15	0	0	1341	0	50
51	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	1367	1625			2295613	957325	18	136:Membrane Protein	15	0	0	1341	0	51
52	PFAM:PF07591		Pretoxin HINT domain	1371	1501	96.3	1.7E-27	2295596	957325	443	15	0	0	1341	0	52
53	PROSITE_PROFILES:PS50818	IPR030934	Intein C-terminal splicing motif profile.	1476	1501			2295619	957325	445	15	0	0	1341	0	53

↑ Top