Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_032485415.1: Clostridium sp., na [+] (ncbi)

Genbanks info:

Genbank_acc: WP_027098337.1:PROKKA_02797
Genome uid: 232
56580-57185 [+] (201)

Sequence:

NPYEVLGIKPGASQEEIKSAYRKLVKQYHPDQYRDNPLQELAQQKLAEVNDAYNQLTSGKSSGNYSSNTSSSYSNNNSYS
NSASELSQARAYLQRRNTAAAEAILNRVSDRNAEWYFLMGVVHSNKGWYDSALQNITTAANMDPNNFEYRQTLQQLSSRA
RGYGQPYYRTTGGNSADCCANLICLDCCCEAMGGDLISCC

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	SMART:SM00271	IPR001623		0	62			3058659	981897	1	0	0	0	1342	0	1
2	PFAM:PF00226	IPR001623	DnaJ domain	1	62	63.8	1.2E-17	3058660	981897	2688	0	0	0	1342	0	2
3	PROSITE_PROFILES:PS50076	IPR001623	dnaJ domain profile.	1	70			3058661	981897	2691	0	0	0	1342	0	3
4	CDD:cd06257	IPR001623	DnaJ	1	58			3058663	981897	2692	0	0	0	1342	0	4
5	SUPERFAMILY:SSF46565	IPR036869	Chaperone J-domain superfamily	1	59			3058664	981897	2695	0	0	0	1342	0	5
6	PRINTS:PR00625	IPR001623	DnaJ domain signature	3	22			3058658	981897	2686	0	0	0	1342	0	6
7	PRINTS:PR00625	IPR001623	DnaJ domain signature	21	37			3058657	981897	2686	0	0	0	1342	0	7
8	PRINTS:PR00625	IPR001623	DnaJ domain signature	41	62			3058656	981897	2686	0	0	0	1342	0	8
9	SUPERFAMILY:SSF48452	IPR011990	Tetratricopeptide-like helical domain superfamily	81	161			3058665	981897	279	0	0	0	1342	0	9
10	PROSITE_PROFILES:PS50005	IPR019734	TPR repeat profile.	113	147			3058662	981897	936	0	0	0	1342	0	10

↑ Top