Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_032485415.1: Clostridium sp., na [+] (ncbi)

Genbanks info:

Genbank_acc: PROKKA_01954
Genome uid: 232
100037-100789 [+] (250)

Sequence:

VVLPSDHYIENEKNYVETLNQAVELANRRRGIVTLGIEPTRPETGYGYIEMGERISGNIATYKVARFTEKPNVEVAKDFL
VKETYLWNSGMFVFRADVILREIEKYLPKMHKALMEIYKHVGEEDEEEVIKEQYELIDGISIDFGVMQKTRKAYVIRCDF
PWDDIGSFSALSRFLVSYRNNNVSKNVYLEECENCSIFGEKNLIIGLGVKDLVVVDAGDVILVMDRARDQEIKHLLNNLS
KNEEYHRFL

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	SUPERFAMILY:SSF53448	IPR029044	Nucleotide-diphospho-sugar transferases	0	173			3065909	982448	753	0	0	0	1893	0	1
2	PHOBIUS:SIGNAL_PEPTIDE_N_REGION		N-terminal region of a signal peptide.	0	6			1644078	982448	21	135:all secretion /signal peptide, lipo	0	0	1	1893	3	2
3	PHOBIUS:SIGNAL_PEPTIDE		Signal peptide region	0	20			1644076	982448	19	135:all secretion /signal peptide, lipo	0	0	1	1893	3	3
4	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	0	5			2325929	982448	3	136:Membrane Protein	0	0	0	1893	0	4
5	PHOBIUS:SIGNAL_PEPTIDE		Signal peptide region	0	26			2937850	982448	19	135:all secretion /signal peptide, lipo	0	0	0	1893	3	5
6	PHOBIUS:SIGNAL_PEPTIDE_N_REGION		N-terminal region of a signal peptide.	0	7			2937852	982448	21	135:all secretion /signal peptide, lipo	0	0	0	1893	3	6
7	PHOBIUS:SIGNAL_PEPTIDE_N_REGION		N-terminal region of a signal peptide.	0	1			483859	982448	21	135:all secretion /signal peptide, lipo	0	0	1	1893	3	7
8	PFAM:PF00483	IPR005835	Nucleotidyl transferase	0	174	87.3	1.1E-24	3065907	982448	1579	0	0	0	1893	0	8
9	PHOBIUS:SIGNAL_PEPTIDE		Signal peptide region	0	14			483861	982448	19	135:all secretion /signal peptide, lipo	0	0	1	1893	3	9
10	DeepTMHMM:outside		outside	1	6			2344122	982448	10025	0	0	0	1893	0	10
11	PHOBIUS:SIGNAL_PEPTIDE_H_REGION		Hydrophobic region of a signal peptide.	1	9			483853	982448	24	135:all secretion /signal peptide, lipo	0	0	1	1893	3	11
12	SUPERFAMILY:SSF52440	IPR016185	Pre-ATP-grasp domain superfamily	2	116			2672865	982448	1296	0	0	0	1893	0	12
13	SUPERFAMILY:SSF51735	IPR036291	NAD(P)-binding domain superfamily	3	255			1644082	982448	206	0	0	1	1893	0	13
14	PFAM:PF01820	IPR011127	D-ala D-ala ligase N-terminus	5	107	82.9	2.1E-23	2672863	982448	1294	0	0	0	1893	0	14
15	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	5	26			2325914	982448	5	136:Membrane Protein	0	0	0	1893	0	15
16	PRINTS:PR00081	IPR002347	Glucose/ribitol dehydrogenase family signature	6	24			1644059	982448	2301	0	0	1	1893	0	16
17	PHOBIUS:SIGNAL_PEPTIDE_H_REGION		Hydrophobic region of a signal peptide.	6	15			1644079	982448	24	135:all secretion /signal peptide, lipo	0	0	1	1893	3	17
18	DeepTMHMM:TMhelix		TMhelix	7	25			2344123	982448	2056	141:DeepTMHMM: helix	0	0	0	1893	6	18
19	PFAM:PF03547	IPR004776	Membrane transport protein	7	156	63	1.6E-17	2325912	982448	1369	136:Membrane Protein	0	0	0	1893	0	19
20	CDD:cd05233		SDR_c	7	250			1644081	982448	4389	0	0	1	1893	0	20
21	PHOBIUS:SIGNAL_PEPTIDE_H_REGION		Hydrophobic region of a signal peptide.	7	19			2937851	982448	24	135:all secretion /signal peptide, lipo	0	0	0	1893	3	21
22	PHOBIUS:SIGNAL_PEPTIDE_C_REGION		C-terminal region of a signal peptide.	9	14			483855	982448	26	135:all secretion /signal peptide, lipo	0	0	1	1893	3	22
23	SIGNALP6:SP		SP	12	13	0		467551	982448	1978	135:all secretion /signal peptide, lipo	0	0	1	1893	0	23
24	PFAM:PF13561		Enoyl-(Acyl carrier protein) reductase	12	254	184.4	0	1644075	982448	2302	0	0	1	1893	0	24
25	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	14	572			483857	982448	3	136:Membrane Protein	0	0	1	1893	0	25
26	SUPERFAMILY:SSF52518	IPR029061	Thiamin diphosphate-binding fold	14	232			2758188	982448	9	0	0	0	1893	0	26
27	PHOBIUS:SIGNAL_PEPTIDE_C_REGION		C-terminal region of a signal peptide.	15	20			1644077	982448	26	135:all secretion /signal peptide, lipo	0	0	1	1893	3	27
28	PHOBIUS:SIGNAL_PEPTIDE_C_REGION		C-terminal region of a signal peptide.	19	26			2937853	982448	26	135:all secretion /signal peptide, lipo	0	0	0	1893	3	28
29	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	20	256			1644080	982448	3	136:Membrane Protein	0	0	1	1893	0	29
30	PFAM:PF05681	IPR004646	Fumarate hydratase (Fumerase)	22	288	251.9	0	2708937	982448	197	0	0	0	1893	0	30
31	DeepTMHMM:inside		inside	26	36			2344124	982448	9730	0	0	0	1893	0	31
32	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	26	37			2325926	982448	18	136:Membrane Protein	0	0	0	1893	0	32
33	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	26	225			2937854	982448	3	136:Membrane Protein	0	0	0	1893	0	33
34	SIGNALP6:SP		SP	35	36	0		2942879	982448	1978	135:all secretion /signal peptide, lipo	0	0	0	1893	3	34
35	DeepTMHMM:TMhelix		TMhelix	37	57			2344125	982448	2056	141:DeepTMHMM: helix	0	0	0	1893	6	35
36	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	37	59			2325919	982448	5	136:Membrane Protein	0	0	0	1893	0	36
37	SMART:SM00287	IPR003646		38	101			2937847	982448	1	0	0	0	1893	0	37
38	PROSITE_PROFILES:PS51781	IPR003646	SH3b domain profile.	38	101			2937856	982448	2101	0	0	0	1893	0	38
39	PFAM:PF08239	IPR003646	Bacterial SH3 domain	48	97	34.4	2.1E-8	2937849	982448	2133	0	0	0	1893	0	39
40	PFAM:PF02775	IPR011766	Thiamine pyrophosphate enzyme, C-terminal TPP binding domain	49	200	68.4	5.9E-19	2758187	982448	174	0	0	0	1893	0	40
41	DeepTMHMM:outside		outside	58	69			2344126	982448	10025	0	0	0	1893	0	41
42	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	59	70			2325930	982448	3	136:Membrane Protein	0	0	0	1893	0	42
43	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	70	91			2325916	982448	5	136:Membrane Protein	0	0	0	1893	0	43
44	DeepTMHMM:TMhelix		TMhelix	70	91			2344127	982448	2056	141:DeepTMHMM: helix	0	0	0	1893	6	44
45	PRINTS:PR00080	IPR002347	Short-chain dehydrogenase/reductase (SDR) superfamily signature	80	92			1644073	982448	2300	0	0	1	1893	0	45
46	PRINTS:PR00081	IPR002347	Glucose/ribitol dehydrogenase family signature	80	92			1644064	982448	2301	0	0	1	1893	0	46
47	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	91	102			2325925	982448	18	136:Membrane Protein	0	0	0	1893	0	47
48	DeepTMHMM:inside		inside	92	109			2344128	982448	9730	0	0	0	1893	0	48
49	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	102	124			2325922	982448	5	136:Membrane Protein	0	0	0	1893	0	49
50	PROSITE_PROFILES:PS51935	IPR000064	NlpC/P60 domain profile.	109	225			2937855	982448	2100	0	0	0	1893	0	50
51	DeepTMHMM:TMhelix		TMhelix	110	119			2344129	982448	2056	141:DeepTMHMM: helix	0	0	0	1893	6	51
52	SUPERFAMILY:SSF54001	IPR038765	Papain-like cysteine peptidase superfamily	110	224			2937857	982448	844	0	0	0	1893	0	52
53	SUPERFAMILY:SSF56059		-	116	329			2672866	982448	12	0	0	0	1893	0	53
54	DeepTMHMM:outside		outside	120	128			2344130	982448	10025	0	0	0	1893	0	54
55	PROSITE_PROFILES:PS50853	IPR003961	Fibronectin type-III domain profile.	120	211			483863	982448	808	0	0	1	1893	0	55
56	PROSITE_PROFILES:PS50975	IPR011761	ATP-grasp fold profile.	121	328			2672864	982448	1295	0	0	0	1893	0	56
57	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	124	129			2325932	982448	3	136:Membrane Protein	0	0	0	1893	0	57
58	PFAM:PF00877	IPR000064	NlpC/P60 family	124	210	76.4	1.5E-21	2937848	982448	2098	0	0	0	1893	0	58
59	PFAM:PF07478	IPR011095	D-ala D-ala ligase C-terminus	127	327	216.8	0	2672862	982448	1293	0	0	0	1893	0	59
60	PRINTS:PR00081	IPR002347	Glucose/ribitol dehydrogenase family signature	127	144			1644057	982448	2301	0	0	1	1893	0	60
61	DeepTMHMM:TMhelix		TMhelix	129	149			2344131	982448	2056	141:DeepTMHMM: helix	0	0	0	1893	6	61
62	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	129	152			2325915	982448	5	136:Membrane Protein	0	0	0	1893	0	62
63	PRINTS:PR00080	IPR002347	Short-chain dehydrogenase/reductase (SDR) superfamily signature	133	142			1644072	982448	2300	0	0	1	1893	0	63
64	SUPERFAMILY:SSF49265	IPR036116	Fibronectin type III superfamily	135	308			483869	982448	318	4:S-layer Homology:PFAM	0	0	1	1893	0	64
65	DeepTMHMM:inside		inside	150	166			2344132	982448	9730	0	0	0	1893	0	65
66	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	152	172			2325928	982448	18	136:Membrane Protein	0	0	0	1893	0	66
67	PRINTS:PR00081	IPR002347	Glucose/ribitol dehydrogenase family signature	153	173			1644062	982448	2301	0	0	1	1893	0	67
68	PRINTS:PR00080	IPR002347	Short-chain dehydrogenase/reductase (SDR) superfamily signature	153	173			1644074	982448	2300	0	0	1	1893	0	68
69	PFAM:PF03547	IPR004776	Membrane transport protein	162	321	36	2.6E-9	2325913	982448	1369	136:Membrane Protein	0	0	0	1893	0	69
70	DeepTMHMM:TMhelix		TMhelix	167	186			2344133	982448	2056	141:DeepTMHMM: helix	0	0	0	1893	6	70
71	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	172	190			2325921	982448	5	136:Membrane Protein	0	0	0	1893	0	71
72	PRINTS:PR00081	IPR002347	Glucose/ribitol dehydrogenase family signature	174	192			1644063	982448	2301	0	0	1	1893	0	72
73	SUPERFAMILY:SSF159283		-	179	241			3065908	982448	12	0	0	0	1893	0	73
74	DeepTMHMM:outside		outside	187	205			2344134	982448	10025	0	0	0	1893	0	74
75	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	190	209			2325933	982448	3	136:Membrane Protein	0	0	0	1893	0	75
76	DeepTMHMM:TMhelix		TMhelix	206	226			2344135	982448	2056	141:DeepTMHMM: helix	0	0	0	1893	6	76
77	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	209	229			2325918	982448	5	136:Membrane Protein	0	0	0	1893	0	77
78	PROSITE_PROFILES:PS50853	IPR003961	Fibronectin type-III domain profile.	211	310			483865	982448	808	0	0	1	1893	0	78
79	PRINTS:PR00081	IPR002347	Glucose/ribitol dehydrogenase family signature	216	237			1644071	982448	2301	0	0	1	1893	0	79
80	DeepTMHMM:inside		inside	227	242			2344136	982448	9730	0	0	0	1893	0	80
81	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	229	240			2325927	982448	18	136:Membrane Protein	0	0	0	1893	0	81
82	CDD:cd00063	IPR003961	FN3	235	307			483867	982448	508	35:FN3	0	0	1	1893	0	82
83	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	240	266			2325920	982448	5	136:Membrane Protein	0	0	0	1893	0	83
84	DeepTMHMM:TMhelix		TMhelix	243	265			2344137	982448	2056	141:DeepTMHMM: helix	0	0	0	1893	6	84
85	DeepTMHMM:outside		outside	266	274			2344138	982448	10025	0	0	0	1893	0	85
86	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	266	271			2325934	982448	3	136:Membrane Protein	0	0	0	1893	0	86
87	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	271	294			2325923	982448	5	136:Membrane Protein	0	0	0	1893	0	87
88	DeepTMHMM:TMhelix		TMhelix	275	289			2344139	982448	2056	141:DeepTMHMM: helix	0	0	0	1893	6	88
89	DeepTMHMM:inside		inside	290	301			2344140	982448	9730	0	0	0	1893	0	89
90	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	294	305			2325924	982448	18	136:Membrane Protein	0	0	0	1893	0	90
91	DeepTMHMM:TMhelix		TMhelix	302	325			2344141	982448	2056	141:DeepTMHMM: helix	0	0	0	1893	6	91
92	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	305	328			2325917	982448	5	136:Membrane Protein	0	0	0	1893	0	92
93	DeepTMHMM:outside		outside	326	329			2344142	982448	10025	0	0	0	1893	0	93
94	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	328	329			2325931	982448	3	136:Membrane Protein	0	0	0	1893	0	94
95	PFAM:PF13585		CHU_C Type IX secretion signal domain	487	556	44.6	1.1E-11	483852	982448	8975	0	0	1	1893	0	95

↑ Top