We will take the links to it out when ready.
GCF_032485415.1: Clostridium sp., na [+] (ncbi)
KGKKKRIAQYKQIEKDILDKIQTGYFKQNDMIPTELELSKTYNVSRVTVRRATDNLVAQGLLYRTAGVGTFVNHNPATQK IATLKSFTEEMEELGLKAYTKINSFSIIEADSKIARMIGVKPNDMIYYIERIRYGNDDIFVFEKTYMSVKDNPDISIRVL EESKYYYFEHVRNKKIDYSYHQTYPIMPPKSIAELFNLDDNTPIIKIGNTTYLEDGSILDYTELYLNSPKYQLNYIRTR
| extraction_method | ipr_acc | domain | start | end | score | evalue | rowid | gbid | domain_id | mod_id | cat_id | redundant | used | ord | mod_group | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1 | SUPERFAMILY:SSF46785 | IPR036390 | Winged helix DNA-binding domain superfamily | 3 | 77 | 3059407 | 983547 | 42 | 0 | 0 | 0 | 2992 | 0 | 1 | |||
| 2 | PROSITE_PROFILES:PS50949 | IPR000524 | GntR-type HTH domain profile. | 7 | 76 | 3059405 | 983547 | 323 | 0 | 0 | 0 | 2992 | 0 | 2 | |||
| 3 | PFAM:PF00392 | IPR000524 | Bacterial regulatory proteins, gntR family | 9 | 73 | 59 | 2.6E-16 | 3059404 | 983547 | 322 | 0 | 0 | 0 | 2992 | 0 | 3 | |
| 4 | CDD:cd07377 | IPR000524 | WHTH_GntR | 10 | 74 | 3059406 | 983547 | 324 | 0 | 0 | 0 | 2992 | 0 | 4 | |||
| 5 | SMART:SM00345 | IPR000524 | 13 | 73 | 3059402 | 983547 | 1 | 0 | 0 | 0 | 2992 | 0 | 5 | ||||
| 6 | PRINTS:PR00035 | IPR000524 | GntR bacterial regulatory protein HTH signature | 32 | 47 | 3059399 | 983547 | 2145 | 0 | 0 | 0 | 2992 | 0 | 6 | |||
| 7 | PRINTS:PR00035 | IPR000524 | GntR bacterial regulatory protein HTH signature | 46 | 63 | 3059400 | 983547 | 2145 | 0 | 0 | 0 | 2992 | 0 | 7 | |||
| 8 | SUPERFAMILY:SSF64288 | IPR028978 | Chorismate pyruvate-lyase/UbiC transcription regulator-associated domain superfamily | 60 | 238 | 3059408 | 983547 | 2147 | 0 | 0 | 0 | 2992 | 0 | 8 | |||
| 9 | SMART:SM00866 | IPR011663 | 93 | 233 | 3059401 | 983547 | 1 | 0 | 0 | 0 | 2992 | 0 | 9 | ||||
| 10 | PFAM:PF07702 | IPR011663 | UTRA domain | 94 | 232 | 90.6 | 8.3E-26 | 3059403 | 983547 | 2146 | 0 | 0 | 0 | 2992 | 0 | 10 |