Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_032478955.1: Clostridium sp., na [+] (ncbi)

Genbanks info:

Genbank_acc: PROKKA_01777
Genome uid: 233
10-702 [+] (230)

Sequence:

QLIDTMSSIGSSELKEYYLKYENVIIKNCLKVLKTINNLIDAVKIDAHELKVDFKNFNIVYLIEDIISRSVKYANIKNQN
LIFDTEIEELIIKCDPNLIEKIILSILSNILMVSFEKSEILISVLERKHYINIVFKYRGNGFNNSIFNVFNNDTKSCPFN
TYAKDLSIAKSLLELQNGKVYVNNKCDDGNEVVILLPKLKFQYLNKNTIMDTYDINDINVAMEFCDLIS

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	0	11			626753	984664	18	136:Membrane Protein	15	0	1	14	0	1
2	PROSITE_PROFILES:PS50109	IPR005467	Histidine kinase domain profile.	0	201			3146439	984664	103	0	0	0	14	0	2
3	DeepTMHMM:inside		inside	1	15			675187	984664	9730	15	0	1	14	0	3
4	SUPERFAMILY:SSF110710	IPR028345	Aminoglycoside 3-N-acetyltransferase-like	5	183			2729967	984664	4776	0	0	0	14	0	4
5	SUPERFAMILY:SSF53697	IPR046348	SIS domain superfamily	9	318			2665531	984664	997	0	0	0	14	0	5
6	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	11	30			626751	984664	5	136:Membrane Protein	15	0	1	14	0	6
7	PFAM:PF04260	IPR006340	Protein of unknown function (DUF436)	11	181	253.6	0	2729966	984664	4775	0	0	0	14	0	7
8	DeepTMHMM:TMhelix		TMhelix	16	31			675188	984664	2056	141:DeepTMHMM: helix	15	0	1	14	6	8
9	SUPERFAMILY:SSF51703	IPR016176	Cobalamin (vitamin B12)-dependent enzyme, catalytic	18	541			898911	984664	8987	15	0	1	14	0	9
10	CDD:cd03679		MM_CoA_mutase_alpha_like	18	539			898910	984664	9893	15	0	1	14	0	10
11	PFAM:PF01642	IPR006099	Methylmalonyl-CoA mutase	26	539	777.5	0	898906	984664	9866	15	0	1	14	0	11
12	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	30	49			626752	984664	3	136:Membrane Protein	15	0	1	14	0	12
13	DeepTMHMM:outside		outside	32	49			675189	984664	10025	15	0	1	14	0	13
14	PROSITE_PROFILES:PS51464	IPR001347	SIS domain profile.	34	178			2665526	984664	2607	0	0	0	14	0	14
15	SUPERFAMILY:SSF55874	IPR036890	Histidine kinase/HSP90-like ATPase superfamily	37	203			3146441	984664	122	0	0	0	14	0	15
16	PFAM:PF01380	IPR001347	SIS domain	39	171	89.7	1.3E-25	2665525	984664	2605	0	0	0	14	0	16
17	CDD:cd05014	IPR035474	SIS_Kpsf	43	171			2665529	984664	4229	0	0	0	14	0	17
18	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	49	70			626750	984664	5	136:Membrane Protein	15	0	1	14	0	18
19	DeepTMHMM:TMhelix		TMhelix	50	70			675190	984664	2056	141:DeepTMHMM: helix	15	0	1	14	6	19
20	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	70	78			626754	984664	18	136:Membrane Protein	15	0	1	14	0	20
21	DeepTMHMM:inside		inside	71	78			675191	984664	9730	15	0	1	14	0	21
22	CDD:cd00075		HATPase	99	197			3146440	984664	456	0	0	0	14	0	22
23	CDD:cd04604		CBS_pair_SIS_assoc	195	319			2665530	984664	8924	0	0	0	14	0	23
24	PFAM:PF00571	IPR000644	CBS domain	199	256	18.5	0.0021	2665524	984664	1430	0	0	0	14	0	24
25	PROSITE_PROFILES:PS51371	IPR000644	CBS domain profile.	203	262			2665528	984664	1439	0	0	0	14	0	25
26	SMART:SM00116	IPR000644		208	257			2665522	984664	1	0	0	0	14	0	26
27	PFAM:PF00571	IPR000644	CBS domain	267	318	34.1	2.8E-8	2665523	984664	1430	0	0	0	14	0	27
28	PROSITE_PROFILES:PS51371	IPR000644	CBS domain profile.	270	328			2665527	984664	1439	0	0	0	14	0	28
29	SMART:SM00116	IPR000644		273	322			2665521	984664	1	0	0	0	14	0	29
30	SUPERFAMILY:SSF52242	IPR036724	Cobalamin-binding domain superfamily	544	705			898915	984664	2210	15	0	1	14	0	30
31	PROSITE_PROFILES:PS51332	IPR006158	B12-binding domain profile.	578	706			898907	984664	2060	15	0	1	14	0	31
32	CDD:cd02071		MM_CoA_mut_B12_BD	580	702			898908	984664	9896	15	0	1	14	0	32
33	PFAM:PF02310	IPR006158	B12 binding domain	580	693	54.5	1.1E-14	898905	984664	2058	15	0	1	14	0	33

↑ Top