We will take the links to it out when ready.
GCF_032478635.1: Clostridium sp., na [+] (ncbi)
FEFNDESPIYIQIANTIEDGILNGIYEEEEQVPSTTEISVTYKINPATVGKGYNLLVGDNIIYKKRGVGMFVCSGAKEKL KKKRRATFFDNYVSKLIEEGKRLGITSDEVIEMIKRGLSNE
| extraction_method | ipr_acc | domain | start | end | score | evalue | rowid | gbid | domain_id | mod_id | cat_id | redundant | used | ord | mod_group | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1 | SUPERFAMILY:SSF46785 | IPR036390 | Winged helix DNA-binding domain superfamily | 0 | 77 | 3266236 | 995351 | 42 | 0 | 0 | 0 | 2511 | 0 | 1 | |||
| 2 | PROSITE_PROFILES:PS50949 | IPR000524 | GntR-type HTH domain profile. | 7 | 76 | 3266234 | 995351 | 323 | 0 | 0 | 0 | 2511 | 0 | 2 | |||
| 3 | CDD:cd07377 | IPR000524 | WHTH_GntR | 8 | 74 | 3266235 | 995351 | 324 | 0 | 0 | 0 | 2511 | 0 | 3 | |||
| 4 | PFAM:PF00392 | IPR000524 | Bacterial regulatory proteins, gntR family | 10 | 73 | 33 | 3.5E-8 | 3266233 | 995351 | 322 | 0 | 0 | 0 | 2511 | 0 | 4 | |
| 5 | SMART:SM00345 | IPR000524 | 13 | 73 | 3266232 | 995351 | 1 | 0 | 0 | 0 | 2511 | 0 | 5 |